Between all the crack that you smoke and VSTis that you develop, I'm shocked you have any time left to post stupid gibberish like this!xoxos wrote:you guy actually let your mood be governed by your environment/playing recordings?
seriously.. not me.. but don't *you* think you're kind of pathetic???
if your dumb ass needs to be programmed to stop bumping into clearly visible solid objects, et c., may i suggest damon edges' chrome.
why?
because, as anyone will tell you, w/o helios, chrome went to shit, so you get 30 minutes of overtly sucky garbage instead of sucky garbage that wants you to think it's the queen.
but then again, civilised people do need to feel that sense of entitlement or they'd be uncomfortably out of place aww diddums
f**king civilised people with chocolate cakes on little doilies coming out they speakers, all perfect and 'ahh, here's my recording, i am now the master because i am the perfect receptor'
you can see the little 'betty crocker' spoon in the corner, dumbfucks
music for the darker days
-
- KVRAF
- 4822 posts since 14 Mar, 2002 from Somewhere else, on principle
-
- KVRAF
- 3588 posts since 13 May, 2004 from montreal
Generally I just work on my own stuff and that does the job. Though one should never underrate Current 93 in this department. Or Roger K's Brighter Death Now.
-
- KVRAF
- 3588 posts since 13 May, 2004 from montreal
-
- Banned
- 12367 posts since 30 Apr, 2002 from i might peeramid
sorry man, the activity of "playing recordings" strikes me as nothing more than the by-product of industrialism, w/o which neither the recordings nor the envaluation thereof would be pertinent..JohnVulich wrote: Between all the crack that you smoke and VSTis that you develop, I'm shocked you have any time left to post stupid gibberish like this!
eg. you've seen those disney films that come out every 5 minutes where the modern kid goes back to king arthur's court and impresses everyone with the power of his righteous portable cd player.. he presses the button, all these techno-primitiv people are AWED by this AMAZING sound
(....)
i'd say more if i thought anyone was listening to what i said instead of what hollywood told them to think
but no! obviously for you morons, it's important to let people know! that you stand against the bad-doers!
but you won't lift a f**king finger of reason to stop yourselves from handing them your money to suck their crap fantastic batman pap. who is the fucknig crack smoking addict "john"
"i just dont see how they can be that evil, after all, theyre americans, like me, they just want pizza??"
you come and go, you come and go. amitabha neither a follower nor a leader be tagore "where roads are made i lose my way" where there is certainty, consideration is absent.
-
- Banned
- 12367 posts since 30 Apr, 2002 from i might peeramid
i mean, wtf???
do you think i roll on the apache reservation and lay out the ambient jams and they're like "oooh, ambient music, NOW i can REALLY RELAX, this is just what i needed sounds that are patterned that occur in realtime!"

30 second attention span eh
do you think i roll on the apache reservation and lay out the ambient jams and they're like "oooh, ambient music, NOW i can REALLY RELAX, this is just what i needed sounds that are patterned that occur in realtime!"
30 second attention span eh
you come and go, you come and go. amitabha neither a follower nor a leader be tagore "where roads are made i lose my way" where there is certainty, consideration is absent.
-
- KVRAF
- 10597 posts since 13 Jun, 2004 from Alberto Balsam
Meh I hate the drums in that song. i usually like portishead drums but I think the song would best with just her voice and that guitar (or rhodes - I cant tell if its rhodes or guitar)luCiPHer wrote:roads without drums?Chase wrote:Oh shit I dont even know how I forgot portisheadSicklecell666 wrote:Don't forget Portishead! First time I ever heard them was a CLASSIC rainy day/blow my brains out situation..
the beginning of 'Roads' is soothing no matter how bad the doldrums are (wish there were no drums, though)
Wandering star, Only you, Mysterons, all good tunes.
would totally destroy it, portishead is all about the drums, the singer and some backgroundtextures (rhodes and stuff), in THAT order.
oh, and i'm one of those guys that prefer the SECOND album
-
- Banned
- 12367 posts since 30 Apr, 2002 from i might peeramid
chase said "i like it"
you come and go, you come and go. amitabha neither a follower nor a leader be tagore "where roads are made i lose my way" where there is certainty, consideration is absent.
-
- KVRAF
- 10597 posts since 13 Jun, 2004 from Alberto Balsam
que?xoxos wrote:chase said "i like it"
I dont think there is anything wrong with using music to sooth yourself when youre down. It's either that, binaural beat frequencies (being discussed in another thread), meditation or biting the bullet.
I choose music.
-
- Boss Lovin' DR
- 14312 posts since 15 Mar, 2002 from the grimness of yorkshire
1,2,3,4,5,6,7, 3 6 9 all the time t,t,t,t,t, wentyfourhourpartypeopleplasticfacecantsmileyerwhiteout.xoxos wrote:sorry man, the activity of "playing recordings" strikes me as nothing more than the by-product of industrialism, w/o which neither the recordings nor the envaluation thereof would be pertinent..JohnVulich wrote: Between all the crack that you smoke and VSTis that you develop, I'm shocked you have any time left to post stupid gibberish like this!
eg. you've seen those disney films that come out every 5 minutes where the modern kid goes back to king arthur's court and impresses everyone with the power of his righteous portable cd player.. he presses the button, all these techno-primitiv people are AWED by this AMAZING sound
(....)
i'd say more if i thought anyone was listening to what i said instead of what hollywood told them to think
but no! obviously for you morons, it's important to let people know! that you stand against the bad-doers!
but you won't lift a f**king finger of reason to stop yourselves from handing them your money to suck their crap fantastic batman pap. who is the fucknig crack smoking addict "john"
"i just dont see how they can be that evil, after all, theyre americans, like me, they just want pizza??"
-
- Banned
- 6127 posts since 1 Apr, 2004 from Et in Arcadia Ego
-
- KVRAF
- 10597 posts since 13 Jun, 2004 from Alberto Balsam
frou frou is IMO the most top-notch-illy produced music ever. She shares producers with bjork
-
- KVRist
- 385 posts since 23 Aug, 2003 from Brooklyn, NY
story of my life. albums on my mp3 player:
air - talkie walkie
azure ray - every album
death from above 1979 - you're a woman, i'm a machine
elliott smith - every album
my bloody valentine - loveless
slint - spiderland
sonic youth - sonic nurse
sufjan stevens - illinois
the weakerthans - fallow
air - talkie walkie
azure ray - every album
death from above 1979 - you're a woman, i'm a machine
elliott smith - every album
my bloody valentine - loveless
slint - spiderland
sonic youth - sonic nurse
sufjan stevens - illinois
the weakerthans - fallow
-
- KVRAF
- 6596 posts since 21 Jun, 2004 from Secret Underground Hideout
i haven't felt deeply dark in a while
this mortal coil
crawling chaos
marilyn manson
this mortal coil
crawling chaos
marilyn manson
